Proteintech, 28482-1-AP, GRP Polyclonal antibody

Size: 20ul / 150ul The GRP (28482-1-AP) by Proteintech is a Polyclonal antibody targeting GRP in WB, IHC, ELISA applications with reactivity to Human samples 28482-1-AP targets GRP in WB, IHC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: SH-SY5Y cells Positive IHC detected in: human lung cancer tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Specification Tested Reactivity: Human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29357 Product name: Recombinant human GRP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 49-120 aa of BC004488 Sequence: LMGKKSTGESSSVSERGSLKQQLREYIRWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFK Predict reactive species Full Name: gastrin-releasing peptide Calculated Molecular Weight: 16 kDa Observed Molecular Weight: 16-18 kDa GenBank Accession Number: BC004488 Gene Symbol: GRP Gene ID (NCBI): 2922 RRID: AB_2881152 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P07492 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.