Iright
BRAND / VENDOR: Proteintech

Proteintech, 28502-1-AP, DDX18 Polyclonal antibody

CATALOG NUMBER: 28502-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DDX18 (28502-1-AP) by Proteintech is a Polyclonal antibody targeting DDX18 in WB, IF/ICC, IP, ELISA applications with reactivity to Human, mouse samples 28502-1-AP targets DDX18 in WB, IF/ICC, IP, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive WB detected in: HEK-293T cells, HeLa cells, K-562 cells Positive IP detected in: HEK-293T cells Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: Human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27457 Product name: Recombinant human DDX18 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 7-165 aa of BC001238 Sequence: KLLRKKIEKRNLKLRQRNLKFQGASNLTLSETQNGDVSEETMGSRKVKKSKQKPMNVGLSETQNGGMSQEAVGNIKVTKSPQKSTVLTNGEAAMQSSNSESKKKKKKKRKMVNDAEPDTKKAKTENKGKSEEESAETTKETENNVEKPDNDEDESEVPS Predict reactive species Full Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 18 Calculated Molecular Weight: 75 kDa Observed Molecular Weight: 80-85 kDa GenBank Accession Number: BC001238 Gene Symbol: DDX18 Gene ID (NCBI): 8886 RRID: AB_2881158 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NVP1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924