Proteintech, 28519-1-AP, FUNDC1 Polyclonal antibody

Size: 20ul / 150ul The FUNDC1 (28519-1-AP) by Proteintech is a Polyclonal antibody targeting FUNDC1 in WB, ELISA applications with reactivity to human, mouse, rat samples 28519-1-AP targets FUNDC1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: RAW 264.7 cells, A-673 cells, mouse brain tissue, mouse liver tissue, rat brain tissue, rat liver tissue, C6 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:20000 Background Information FUNDC1 is a novel mitochondrial-associated membrane (MAM) protein, enriched at the MAM by interacting with the ER resident protein CANX (calnexin) under hypoxia. As mitophagy proceeds, it dissociates from CANX and preferably recruits DNM1L/DRP1 to drive mitochondrial fission in response to hypoxic stress. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, monkey, goat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29358 Product name: Recombinant human FUNDC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 96-155 aa of BC042813 Sequence: QIDWKRVEKDVNKAKRQIKKRANKAAPEINNLIEEATEFIKQNIVISSGFVGGFLLGLAS Predict reactive species Full Name: FUN14 domain containing 1 Calculated Molecular Weight: 155 aa, 17 kDa Observed Molecular Weight: 17 kDa GenBank Accession Number: BC042813 Gene Symbol: FUNDC1 Gene ID (NCBI): 139341 RRID: AB_2935469 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IVP5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.