Product Description
Size: 20ul / 150ul
The LEF1 (28540-1-AP) by Proteintech is a Polyclonal antibody targeting LEF1 in WB, IF/ICC, ELISA applications with reactivity to human samples
28540-1-AP targets LEF1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: COLO 320 cells, SW480 cells, Jurkat cells
Positive IF/ICC detected in: HepG2 cells, A549 cells
Recommended dilution
Western Blot (WB): WB : 1:5000-1:50000
Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
Background Information
Lymphoid enhancer-binding factor 1(LEF1) belongs to a family of regulatory protein share homology with high mobility group protein-1, and it's a nuclear protein exprssed in pre-B and T cells. LEF1 has a role in the Wnt signaling pathway and hair cell differentiation and follicle morphogenesis. LEF1 exists as seven isoforms and we detects three isoforms with MW 44 kDa, 36 kDa and 23 kDa. Together with CTNNB1 and EP300, LEF1 activates transcription of target genes. Isoform 5 transcriptionally activates the fibronectin promoter, binds to and represses transcription from the E-cadherin promoter in a CTNNB1-independent manner, and is involved in reducing cellular aggregation and increasing cell migration of pancreatic cancer cells. Isoform 1 transcriptionally activates MYC and CCND1 expression and enhances proliferation of pancreatic tumor cells.
MECs can give rise to seven cell types of the SAE and SMGs following severe airway injury. MECs progressively adopted a basal cell phenotype on the SAE and established lasting progenitors capable of further regeneration following reinjury. MECs activate Wnt-regulated transcription factors (Lef-1/TCF7) following injury and Lef-1 induction in cultured MECs promoted transition to a basal cell phenotype. Surprisingly, dose-dependent MEC conditional activation of Lef-1in vivopromoted self-limited airway regeneration in the absence of injury. Thus, modulating the Lef-1 transcriptional program in MEC-derived progenitors may have regenerative medicine applications for lung diseases. (https://doi.org/10.1016/j.stem.2018.03.017)
The phosphorylation may affects LEF1 protein's theoretical molecular weight when tested.40-70 kD bands have also been reported (PMID:22261717;17063141 ).
Specification
Tested Reactivity: human
Cited Reactivity: human, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag29841 Product name: Recombinant human LEF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-98 aa of BC050632 Sequence: MPQLSGGGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNESEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPD Predict reactive species
Full Name: lymphoid enhancer-binding factor 1
Calculated Molecular Weight: 37 kDa
Observed Molecular Weight: 50 kDa
GenBank Accession Number: BC050632
Gene Symbol: LEF1
Gene ID (NCBI): 51176
ENSEMBL Gene ID: ENSG00000138795
RRID: AB_2881166
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q9UJU2
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924