Proteintech, 28543-1-AP, Integrin Beta 5 Polyclonal antibody

Size: 20ul / 150ul The Integrin Beta 5 (28543-1-AP) by Proteintech is a Polyclonal antibody targeting Integrin Beta 5 in WB, IHC, ELISA applications with reactivity to human, mouse samples 28543-1-AP targets Integrin Beta 5 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A549 cells Positive IHC detected in: human pancreas cancer tissue, mouse placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29783 Product name: Recombinant human Integrin beta-5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-126 aa of BC006541 Sequence: GLNICTSGSATSCEECLLIHPKCAWCSKEDFGSPRSITSRCDLRANLVKNGCGGEIESPASSFHVLRSLPLSSKGSGSAGWDVIQMTPQEIAVNLRPGDKTTF Predict reactive species Full Name: integrin, beta 5 Calculated Molecular Weight: 88 kDa Observed Molecular Weight: 100 kDa GenBank Accession Number: BC006541 Gene Symbol: Integrin beta 5 Gene ID (NCBI): 3693 RRID: AB_2881167 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P18084 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.