Proteintech, 28548-1-AP, ABCE1 Polyclonal antibody

Size: 20ul / 150ul The ABCE1 (28548-1-AP) by Proteintech is a Polyclonal antibody targeting ABCE1 in WB, IHC, ELISA applications with reactivity to human samples 28548-1-AP targets ABCE1 in WB, IHC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HEK-293 cells, HeLa cells, K-562 cells, MCF-7 cells, NCI-H1299 cells Positive IHC detected in: human breast cancer tissue, human ovary tumor tissue, human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29724 Product name: Recombinant human ABCE1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 319-436 aa of BC016283 Sequence: TENLRFRDASLVFKVAETANEEEVKKMCMYKYPGMKKKMGEFELAIVAGEFTDSEIMVMLGENGTGKTTFIRMLAGRLKPDEGGEVPVLNVSYKPQKISPKSTGSVRQLLHEKIRDAY Predict reactive species Full Name: ATP-binding cassette, sub-family E (OABP), member 1 Calculated Molecular Weight: 599 aa, 67 kDa Observed Molecular Weight: 68 kDa GenBank Accession Number: BC016283 Gene Symbol: ABCE1 Gene ID (NCBI): 6059 RRID: AB_2881169 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P61221 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.