Proteintech, 28575-1-AP, TRIM59 Polyclonal antibody

Size: 20ul / 150ul The TRIM59 (28575-1-AP) by Proteintech is a Polyclonal antibody targeting TRIM59 in WB, IHC, IF/ICC, ELISA applications with reactivity to Human, mouse, rat samples 28575-1-AP targets TRIM59 in WB, IHC, IF/ICC, CoIP, ChIP, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: mouse spleen tissue, rat spleen tissue Positive IHC detected in: human pancreas cancer tissue, human liver tissue, human breast cancer tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information TRIM59 belongs to the tripartite motif (TRIM) family. It functions as E3 ubiquitin ligases or an adaptor protein, and plays important roles in various types of human cancers. Specification Tested Reactivity: Human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29560 Product name: Recombinant human TRIM59 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 128-326 aa of NM_173084 Sequence: GHPIDDLQSAYLKEKDTPQKLLEQLTDTHWTDLTHLIEKLKEQKSHSEKMIQGDKEAVLQYFKELNDTLEQKKKSFLTALCDVGNLINQEYTPQIERMKEIREQQLELMALTISLQEESPLKFLEKVDDVRQHVQILKQRPLPEVQPVEIYPRVSKILKEEWSRTEIGQIKNVLIPKMKISPKRMSCSWPGKDEKEVEF Predict reactive species Full Name: tripartite motif-containing 59 Calculated Molecular Weight: 47 kDa Observed Molecular Weight: 47 kDa GenBank Accession Number: NM_173084 Gene Symbol: TRIM59 Gene ID (NCBI): 286827 RRID: AB_2918177 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IWR1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.