Iright
BRAND / VENDOR: Proteintech

Proteintech, 28610-1-AP, WNT16 Polyclonal antibody

CATALOG NUMBER: 28610-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The WNT16 (28610-1-AP) by Proteintech is a Polyclonal antibody targeting WNT16 in WB, ELISA applications with reactivity to Human, mouse, rat samples 28610-1-AP targets WNT16 in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293T cells, rat brain tissue, mouse brain tissue, Ramos cells, Raji cells, LNCaP cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Specification Tested Reactivity: Human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29360 Product name: Recombinant human WNT16 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 29-200 aa of BC104945 Sequence: GNWMWLGIASFGVPEKLGCANLPLNSRQKELCKRKPYLLPSIREGARLGIQECGSQFRHERWNCMITAAATTAPMGASPLFGYELSSGTKETAFIYAVMAAGLVHSVTRSCSAGNMTECSCDTTLQNGGSASEGWHWGGCSDDVQYGMWFSRKFLDFPIGNTTGKENKVLLA Predict reactive species Full Name: wingless-type MMTV integration site family, member 16 Calculated Molecular Weight: 365 aa, 41 kDa Observed Molecular Weight: 41 kDa GenBank Accession Number: BC104945 Gene Symbol: WNT16 Gene ID (NCBI): 51384 RRID: AB_2881181 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UBV4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924