Proteintech, 28628-1-AP, XPO5 Polyclonal antibody

Size: 20ul / 150ul The XPO5 (28628-1-AP) by Proteintech is a Polyclonal antibody targeting XPO5 in WB, IHC, ELISA applications with reactivity to Human, Mouse samples 28628-1-AP targets XPO5 in WB, IHC, ELISA applications and shows reactivity with Human, Mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, K-562 cells Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Specification Tested Reactivity: Human, Mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24217 Product name: Recombinant human XPO5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC000129 Sequence: MRLSQKWQVINQRSLLCGEDEAADENPESQEMLEEQLVRMLTREVMDLITVCCVSKKGADHSSAPPADGDDEEMMATEVTPSAMAELTDLGKCLMKHEDV Predict reactive species Full Name: exportin 5 Calculated Molecular Weight: 136 kDa Observed Molecular Weight: 136 kDa GenBank Accession Number: BC000129 Gene Symbol: XPO5 Gene ID (NCBI): 57510 RRID: AB_2881184 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9HAV4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.