Proteintech, 28632-1-AP, SLC38A1 Polyclonal antibody

Size: 20ul / 150ul The SLC38A1 (28632-1-AP) by Proteintech is a Polyclonal antibody targeting SLC38A1 in WB, IHC, ELISA applications with reactivity to Human, mouse samples 28632-1-AP targets SLC38A1 in WB, IHC, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive WB detected in: A549 cells, mouse brain tissue, mouse skeletal muscle tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:14000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information SLC38A1 (Sodium-coupled neutral amino acid transporter 1), is also named as SNAT1, which is a symporter that cotransports short-chain neutral amino acids and sodium ions from the extraccellular to the intracellular side of the cell membrane (PMID:20599747, PMID:10891391). Inhibition of SLC38A1 reduced tumor growth, cellular migration, invasion, and induced senescence in melanoma cells (PMID:35565278). SLC38A1 was identified as a positive regulator of mTORC1 in neurons, which promoted ischemic brain damage by mTOR-autophagy system (PMID:31552299). SLC38A1 is mainly expressed in brain and placenta. Specification Tested Reactivity: Human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30088 Product name: Recombinant human SLC38A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-74 aa of BC010620 Sequence: MMHFKSGLELTELQNMTVPEDDNISNDSNDFTEVENGQINSKFISDRESRRSLTNSHLEKKKCDEYIPGTTSLG Predict reactive species Full Name: solute carrier family 38, member 1 Calculated Molecular Weight: 487 aa, 54 kDa Observed Molecular Weight: 54 kDa, 60-70 kDa GenBank Accession Number: BC010620 Gene Symbol: SLC38A1 Gene ID (NCBI): 81539 RRID: AB_3086073 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H2H9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.