Iright
BRAND / VENDOR: Proteintech

Proteintech, 28695-1-AP, KNL1 Polyclonal antibody

CATALOG NUMBER: 28695-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The KNL1 (28695-1-AP) by Proteintech is a Polyclonal antibody targeting KNL1 in WB, IF/ICC, ELISA applications with reactivity to human samples 28695-1-AP targets KNL1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information KNL1 is a component of the multiprotein assembly that is required for creation of kinetochore-microtubule attachments and chromosome segregation. KNL1 functions as a scaffold for proteins that influence the spindle assembly checkpoint during the eukaryotic cell cycle and it interacts with at least five different kinetochore proteins and two checkpoint kinases. In adults, this gene is predominantly expressed in normal testes, various cancer cell lines and primary tumors from other tissues and is ubiquitously expressed in fetal tissues. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29881 Product name: Recombinant human KNL1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1746-1896 aa of NM_170589 Sequence: PDEINSSDSINIETEEKALIETYQKEISPYENKMGKTCNSQKRTWVQEEEDIHKEKKIRKNEIKFSDTTQDREIFDHHTEEDIDKSANSVLIKNLSRTPSSCSSSLDSIKADGTSLDFSTYRSSQMESQFLRDTICEESLREKLQDGRITI Predict reactive species Full Name: cancer susceptibility candidate 5 Calculated Molecular Weight: 265 kDa Observed Molecular Weight: 300 kDa GenBank Accession Number: NM_170589 Gene Symbol: CASC5/KNL1 Gene ID (NCBI): 57082 RRID: AB_3086079 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NG31 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924