Proteintech, 28706-1-AP, RALYL Polyclonal antibody

Size: 20ul / 150ul The RALYL (28706-1-AP) by Proteintech is a Polyclonal antibody targeting RALYL in WB, ELISA applications with reactivity to Human samples 28706-1-AP targets RALYL in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HEK-293T cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information RALY RNA binding protein-like (RALYL) belongs to the RALY subfamily. RALYL locates in 8q21.2, the function of which is RNA-binding and nucleotide binding. The RALYL high expression in the normal adrenal, kidney and brain (Shyamsundar et al., 2005). Furthermore, RALYL expression down-regulated correlates with mental disorder (Lee et al., 2007), Parkinson's disease (Moran et al., 2006), brain cancer (Maris et al., 2008), adrenal cancer (Giordano et al., 2009) and kidney cancer (Higgins et al., 2003). The expression of RALYL was significantly low in Clear Cell Renal Cell Carcinoma and correlated with a poor prognosis in a large number of clinical samples. Our findings showed that RALYL may be a potential therapeutic target as well as a poor prognostic Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30310 Product name: Recombinant human RALYL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 223-291 aa of BC031090 Sequence: QQKAEAEAQKKQLEESLVLIQEECVSEIADHSTEEPAEGGPDADGEEMTDGIEEDFDEDGGHELFLQIK Predict reactive species Full Name: RALY RNA binding protein-like Calculated Molecular Weight: 291 aa, 32 kDa Observed Molecular Weight: 33 kDa GenBank Accession Number: BC031090 Gene Symbol: RALYL Gene ID (NCBI): 138046 RRID: AB_2881197 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86SE5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.