Proteintech, 28730-1-AP, SLIT2 Polyclonal antibody

Size: 20ul / 150ul The SLIT2 (28730-1-AP) by Proteintech is a Polyclonal antibody targeting SLIT2 in WB, ELISA applications with reactivity to human samples 28730-1-AP targets SLIT2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information SLIT2, also named as SLIL3, is thought to act as a molecular guidance cue in cellular migration, and function appears to be mediated by interaction with roundabout homolog receptors. During neural development is involved in axonal navigation at the ventral midline of the neural tube and projection of axons to different regions. SLIT1 and SLIT2 seem to be essential for midline guidance in the forebrain by acting as repulsive signal preventing inappropriate midline crossing by axons projecting from the olfactory bulb. In spinal chord development, SLIT2 may play a role in guiding commissural axons once they reached the floor plate by modulating the response to netrin. SLIT2 may be implicated in spinal chord midline post-crossing axon repulsion. In vitro, only commissural axons that crossed the midline responded to SLIT2. In the developing visual system it appears to function as repellent for retinal ganglion axons by providing a repulsion that directs these axons along their appropriate paths prior to, and after passage through, the optic chiasm. In vitro, it collapses and repels retinal ganglion cell growth cones. SLIT2 seems to play a role in branching and arborization of CNS sensory axons, and in neuronal cell migration. It seems to be involved in regulating leukocyte migration. The antibody is specific to SLIT2. Slit2 is cleaved into 140 kDa N-terminal (Slit2-N) and 55-60 kDa C-terminal (Slit2-C) fragments, although the uncleaved/full-length form(200) can also be detected. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30428 Product name: Recombinant human SLIT2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1312-1482 aa of NM_004787 Sequence: YINSELQDFQKVPMQTGILPGCEPCHKKVCAHGTCQPSSQAGFTCECQEGWMGPLCDQRTNDPCLGNKCVHGTCLPINAFSYSCKCLEGHGGVLCDEEEDLFNPCQAIKCKHGKCRLSGLGQPYCECSSGYTGDSCDREISCRGERIRDYYQKQQGYAACQTTKKVSRLEC Predict reactive species Full Name: slit homolog 2 (Drosophila) Calculated Molecular Weight: 170 kDa Observed Molecular Weight: 100 kDa, 200 kDa GenBank Accession Number: NM_004787 Gene Symbol: SLIT2 Gene ID (NCBI): 9353 RRID: AB_2935470 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O94813 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.