Product Description
Size: 20ul / 150ul
The MDMX/MDM4 (28747-1-AP) by Proteintech is a Polyclonal antibody targeting MDMX/MDM4 in WB, IHC, IP, ELISA applications with reactivity to human samples
28747-1-AP targets MDMX/MDM4 in WB, IHC, IP, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: A2780 cells, MCF-7 cells, MDA-MB-231 cells, U2OS cells
Positive IP detected in: MCF-7 cells
Positive IHC detected in: human ovary tumor tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:2000-1:12000
Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC): IHC : 1:50-1:500
Background Information
MDM4 is also named as MDMX. It inhibits the activity of the tumor suppressor p53 by primarily cooperating with the p53 feedback regulator MDM2. MDM4 resides mostly in the cytoplasm, but can be recruited to the nucleus by MDM2.(PMID:16511572). The predicted mass of the protein is 54 kDa, while the observed mass is 70-80 kDa, a difference which stated is probably due to phosphorylation or other posttranslational modification(PMID:9226370, 28097652). It can be ubiquitinated and degraded by MDM2(PMID:16163388). It has 5 isoforms produced by alternative splicing.
Specification
Tested Reactivity: human
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag30456 Product name: Recombinant human MDM4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 359-490 aa of BC067299 Sequence: VPDCRRTISAPVVRPKDAYIKKENSKLFDPCNSVEFLDLAHSSESQETISSMGEQLDNLSEQRTDTENMEDCQNLLKPCSLCEKRPRDGNIIHGRTGHLVTCFHCARRLKKAGASCPICKKEIQLVIKVFIA Predict reactive species
Full Name: Mdm4 p53 binding protein homolog (mouse)
Calculated Molecular Weight: 490 aa, 55 kDa
Observed Molecular Weight: 70-76 kDa
GenBank Accession Number: BC067299
Gene Symbol: MDMX/MDM4
Gene ID (NCBI): 4194
RRID: AB_3086083
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: O15151
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924