Iright
BRAND / VENDOR: Proteintech

Proteintech, 28841-1-AP, MYO1F Polyclonal antibody

CATALOG NUMBER: 28841-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MYO1F (28841-1-AP) by Proteintech is a Polyclonal antibody targeting MYO1F in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 28841-1-AP targets MYO1F in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, rat spleen tissue Positive IF/ICC detected in: THP-1 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Myosin family members are proteins that hydrolyze ATP to generate force or directional movement along actin filaments and are implicated in the rearrangement of the cytoskeleton in several cell types. Myosin 1F (MYO1F), a long tailed class I myosin, is highly expressed in natural killer (NK) cells, macrophages, dendritic cells, and neutrophils. MYO1F plays a critical role in the mediating of signaling molecules "trafficking from membrane to cytoplasm," and this process is essential for the antifungal signaling pathway activation. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29899 Product name: Recombinant human MYO1F protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 198-276 aa of BC028071 Sequence: VMQNENERNFHIYYQLLEGASQEQRQNLGLMTPDYYYYLNQSDTYQVDGTDDRSDFGETLSAMQVIGIPPSIQQLVLQL Predict reactive species Full Name: myosin IF Calculated Molecular Weight: 1098 aa, 125 kDa Observed Molecular Weight: 115-125 kDa GenBank Accession Number: BC028071 Gene Symbol: MYO1F Gene ID (NCBI): 4542 RRID: AB_3669671 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O00160 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924