Iright
BRAND / VENDOR: Proteintech

Proteintech, 28842-1-AP, POLR3A Polyclonal antibody

CATALOG NUMBER: 28842-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The POLR3A (28842-1-AP) by Proteintech is a Polyclonal antibody targeting POLR3A in WB, IF/ICC, ELISA applications with reactivity to human samples 28842-1-AP targets POLR3A in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells, HEK-293 cells, HeLa cells, MCF-7 cells, Y79 cells Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information POLR3A encodes the largest subunit of human RNA polymerase III (RPC1), which contributes to the catalytic activity of Pol III and is part of the active centre of the polymerase. Pol III is responsible for the transcription of untranslated RNAs (PMID: 25339210). Bi-allelic missense variants in POLR3A have been associated with phenotypes distinct from WRS: hypogonadotropic hypogonadism and hypomyelinating leukodystrophy with or without oligodontia (PMID: 30414627). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29036 Product name: Recombinant human POLR3A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-187 aa of BC041089 Sequence: MVKEQFRETDVAKKISHICFGMKSPEEMRQQAHIQVVSKNLYSQDNQHAPLLYGVLDHRMGTSEKDRPCETCGKNLADCLGHYGYIDLELPCFHVGYFRAVIGILQMICKTCCHIMLSQEEKKQFLDYLKRPGLTYLQKRGLKKKISDKCRKKNICHHCGAFNGTVKKCGLLKIIHEKYKTNKKVVD Predict reactive species Full Name: polymerase (RNA) III (DNA directed) polypeptide A, 155kDa Calculated Molecular Weight: 1390 aa, 156 kDa Observed Molecular Weight: 155 kDa GenBank Accession Number: BC041089 Gene Symbol: POLR3A Gene ID (NCBI): 11128 RRID: AB_3669672 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O14802 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924