Iright
BRAND / VENDOR: Proteintech

Proteintech, 28887-1-AP, OPRM1 Polyclonal antibody

CATALOG NUMBER: 28887-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The OPRM1 (28887-1-AP) by Proteintech is a Polyclonal antibody targeting OPRM1 in WB, ELISA applications with reactivity to human samples 28887-1-AP targets OPRM1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: SK-N-SH cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information OPRM1 (also known as Mu opioid receptor, MOR1, MOP) is a G protein-coupled receptor that mediates the physiological effects of endogenous opioids as well as the structurally distinct opioid alkaloids including morphine and etorphine (PMID: 9618555). Mu opioid receptor modulates a wide range of physiological functions, particularly involved in the control of pain perception and reward properties (PMID: 30483121). Mu opioid receptor is the principal target of opioid drugs. It is encoded by OPRM1 gene and multiple transcript variants encoding different isoforms have been found. Mu opioid receptor contains sites for N-linked glycosylation. The transcript variants and variations of glycosylation may result in migrating bands of Mu opioid receptor (PMID: 21886594; 11359768). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30275 Product name: Recombinant human OPRM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-68 aa of BC074927 Sequence: MDSSAAPTNASNCTDALAYSSCSPAPSPGSWVNLSHLDGNLSDPCGPNRTDLGGRDSLCPPTGSPSMI Predict reactive species Full Name: opioid receptor, mu 1 Calculated Molecular Weight: 45 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC074927 Gene Symbol: OPRM1 Gene ID (NCBI): 4988 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P35372 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924