Iright
BRAND / VENDOR: Proteintech

Proteintech, 28936-1-AP, CD46 Polyclonal antibody

CATALOG NUMBER: 28936-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CD46 (28936-1-AP) by Proteintech is a Polyclonal antibody targeting CD46 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 28936-1-AP targets CD46 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells, A549 cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information CD46, also known as Membrane cofactor protein (MCP) or MIC10, is a ubiquitously expressed type type-I transmembrane glycoprotein that acts as a cofactor for complement factor I to mediate inactivation of C3b and C4b deposited on host cells. CD46 is a receptor for a large number of pathogens, including measles virus and adenovirus (PMID: 20941397). CD46 plays a role in linking innate and adaptive immune responses. It may be involved in the fusion of the spermatozoa with the oocyte during fertilization. Mutations of the CD46 gene have been associated with some diseases including hemolytic uremic syndrome (PMID: 26054645). CD46 is expressed on most cells as four isoforms that are derived via alternative splicing (PMID: 15324743). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30376 Product name: Recombinant human CD46 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 38-179 aa of BC030594 Sequence: PPTFEAMELIGKPKPYYEIGERVDYKCKKGYFYIPPLATHTICDRNHTWLPVSDDACYRETCPYIRDPLNGQAVPANGTYEFGYQMHFICNEGYYLIGEEILYCELKGSVAIWSGKPPICEKVLCTPPPKIKNGKHTFSEVE Predict reactive species Full Name: CD46 molecule, complement regulatory protein Calculated Molecular Weight: 384 aa, 43 kDa Observed Molecular Weight: 50-70 kDa GenBank Accession Number: BC030594 Gene Symbol: CD46 Gene ID (NCBI): 4179 RRID: AB_2881233 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P15529 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924