Iright
BRAND / VENDOR: Proteintech

Proteintech, 29087-1-AP, TRMT10C Polyclonal antibody

CATALOG NUMBER: 29087-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TRMT10C (29087-1-AP) by Proteintech is a Polyclonal antibody targeting TRMT10C in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 29087-1-AP targets TRMT10C in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, PC-12 cells, mouse heart tissue, rat heart tissue Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:2000-1:8000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information tRNA methyltransferase 10 homolog C (TRMT10C, also known as MRPP1) is involved in mitochondrial RNA processing and modification (PMID: 21593607). It is essential for the 5'-ends processing of mitochondrial tRNAs and plays a critical role in mitochondrial respiration and translation (PMID: 18984158; 29040705). Mutations in TRMT10C may be a cause of mitochondrial disease and highlight the importance of RNA processing for correct mitochondrial function (PMID: 27132592). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30642 Product name: Recombinant human TRMT10C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 40-178 aa of NM_017819 Sequence: MSSKIPAVTYPKNESTPPSEELELDKWKTTMKSSVQEECVSTISSSKDEDPLAATREFIEMWRLLGREVPEHITEEELKTLMECVSNTAKKKYLKYLYTKEKVKKARQIKKEMKAAAREEAKNIKLLETTEEDKQKNFL Predict reactive species Full Name: RNA (guanine-9-) methyltransferase domain containing 1 Calculated Molecular Weight: 47 kDa Observed Molecular Weight: 40-45 kDa GenBank Accession Number: NM_017819 Gene Symbol: TRMT10C Gene ID (NCBI): 54931 RRID: AB_2881239 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q7L0Y3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924