Iright
BRAND / VENDOR: Proteintech

Proteintech, 29092-1-AP, RPL5 Polyclonal antibody

CATALOG NUMBER: 29092-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RPL5 (29092-1-AP) by Proteintech is a Polyclonal antibody targeting RPL5 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat, monkey samples 29092-1-AP targets RPL5 in WB, IHC, IF/ICC, RIP, ELISA applications and shows reactivity with human, mouse, rat, monkey samples. Tested Applications Positive WB detected in: COS-7 cells, MOLT-4 cells, NIH/3T3 cells, C6 cells, PC-3 cells Positive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U-251 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information The mammalian ribosome is a macromolecular assembly of 4 RNA species (rRNAs) and approximately 80 different proteins, including RPL5. RPL5 (ribosome protein L15) is rquired for rRNA maturation and formation of the 60S ribosomal subunits, and defects or mutation in RPL5 is the cause of DBA6. Specification Tested Reactivity: human, mouse, rat, monkey Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30837 Product name: Recombinant human RPL5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 178-297 aa of BC109370 Sequence: KRFPGYDSESKEFNAEVHRKHIMGQNVADYMRCLMEEDEDAYKKQFSQYIKNSVTPDMMEEMYKKAHAAIRENPVYEKKPKKEVKKKRWNRPKMSLAQKKDRVAQKKASFLRAQERAAES Predict reactive species Full Name: ribosomal protein L5 Observed Molecular Weight: 34 kDa GenBank Accession Number: BC109370 Gene Symbol: RPL5 Gene ID (NCBI): 6125 RRID: AB_2881240 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P46777 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924