Proteintech, 29110-1-AP, RAB20 Polyclonal antibody

Size: 20ul / 150ul The RAB20 (29110-1-AP) by Proteintech is a Polyclonal antibody targeting RAB20 in WB, IHC, ELISA applications with reactivity to Human samples 29110-1-AP targets RAB20 in WB, IHC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HeLa cells, K-562 cells Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information RAB20 is a member of RAS oncogene family, it has no close relationship to any other members of RAB subfamily which consists of small GTP-binding proteins involved in the regulation of intracellullar vesicular transport. Firstly found highly expressed on the apical side of kidney tubuel epithelial cells, RAB20 was speculated to be involved in apical endocytosi and recylcing processes. So far, its function is not well known, however, RAB20 is recently found higher expressed in pancreatic adenocarcinomas than normal pancreas, which is proved by WB and IHC analyses, suggesting its promising role in diagnosis of pancreatic carcinogenesis. Catalog#11616-1-AP is a rabbit polyclonal antibody raised against full-length of human RAB20. Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30459 Product name: Recombinant human RAB20 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 115-234 aa of BC026025 Sequence: VDLTEEGALAGQEKEECSPNMDAGDRVSPRAPKQVQLEDAVALYKKILKYKMLDEQDVPAAEQMCFETSAKTGYNVDLLFETLFDLVVPMILQQRAERPSHTVDISSHKPPKRTRSGCCA Predict reactive species Full Name: RAB20, member RAS oncogene family Calculated Molecular Weight: 26 kDa Observed Molecular Weight: 29 kDa GenBank Accession Number: BC026025 Gene Symbol: RAB20 Gene ID (NCBI): 55647 RRID: AB_3086099 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NX57 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.