Proteintech, 29112-1-AP, GTF2H5 Polyclonal antibody

Size: 20ul / 150ul The GTF2H5 (29112-1-AP) by Proteintech is a Polyclonal antibody targeting GTF2H5 in IHC, ELISA applications with reactivity to human, mouse samples 29112-1-AP targets GTF2H5 in IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse kidney tissue, human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information GTF2H5 (General Transcription Factor IIH Subunit 5) is a protein encoded by the GTF2H5 gene in humans. It is also known by several other names, including TTDA, TFB5, and TFIIH subunit p8. This protein is a critical component of the TFIIH complex, which is involved in both gene transcription and DNA repair. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30758 Product name: Recombinant human GTF2H5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-42 aa of BC060317 Sequence: MVNVLKGVLIECDPAMKQFLLYLDESNALGKKFIIQDIDDTH Predict reactive species Full Name: general transcription factor IIH, polypeptide 5 Calculated Molecular Weight: 8 kDa GenBank Accession Number: BC060317 Gene Symbol: GTF2H5 Gene ID (NCBI): 404672 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6ZYL4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.