Iright
BRAND / VENDOR: Proteintech

Proteintech, 29113-1-AP, RABIF Polyclonal antibody

CATALOG NUMBER: 29113-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RABIF (29113-1-AP) by Proteintech is a Polyclonal antibody targeting RABIF in WB, IHC, IF/ICC, ELISA applications with reactivity to Human, mouse samples 29113-1-AP targets RABIF in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive WB detected in: HL-60 cells, HeLa cells, Jurkat cells Positive IHC detected in: mouse brain tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information RABIF (Rab-interacting factor)/MSS4 (mammalian suppressor of Sec4) was the first putative guanine nucleotide exchange factors (GEFs) isolated for Rabs, which may act as a chaperone, allowing interacting Rab proteins to be properly activated where and when they are needed in the cell (PMID: 25158853). RABIF is a 17-kDa protein that is expressed in all mammalian tissues and is in complex with nucleotide-free Rab8 GTPase and Rab10 GTPase (PMID: 28894007, 28228250). Specification Tested Reactivity: Human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30761 Product name: Recombinant human RABIF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-72 aa of BC018488 Sequence: MEPAEQPSELVSAEGRNRKAVLCQRCGSRVLQPGTALFSRRQLFLPSMRKKPALSDGSNPDGDLLQEHWLVE Predict reactive species Full Name: RAB interacting factor Calculated Molecular Weight: 123 aa, 14 kDa Observed Molecular Weight: 14 kDa GenBank Accession Number: BC018488 Gene Symbol: RABIF Gene ID (NCBI): 5877 RRID: AB_3669674 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P47224 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924