Proteintech, 29183-1-AP, GANAB Polyclonal antibody

Size: 20ul / 150ul The GANAB (29183-1-AP) by Proteintech is a Polyclonal antibody targeting GANAB in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 29183-1-AP targets GANAB in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse kidney tissue, HeLa cells, mouse liver, rat liver Positive IHC detected in: mouse liver tissue, human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30417 Product name: Recombinant human GANAB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 350-488 aa of BC017435 Sequence: GGTIVPRWMRVRRSSECMKDDPITLFVALSPQGTAQGELFLDDGHTFNYQTRQEFLLRRFSFSGNTLVSSSADPEGHFETPIWIERVVIIGAGKPAAVVLQTKGSPESRLSFQHDPETSVLVLRKPGINVASDWSIHLR Predict reactive species Full Name: glucosidase, alpha; neutral AB Calculated Molecular Weight: 944aa,107 kDa; 488aa,55 kDa Observed Molecular Weight: 110-120 kDa GenBank Accession Number: BC017435 Gene Symbol: GANAB Gene ID (NCBI): 23193 RRID: AB_2918244 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14697 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.