Proteintech, 29219-1-AP, CBLL1 Polyclonal antibody

Size: 20ul / 150ul The CBLL1 (29219-1-AP) by Proteintech is a Polyclonal antibody targeting CBLL1 in WB, IHC, ELISA applications with reactivity to human samples 29219-1-AP targets CBLL1 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells, NCI-H1299 cells Positive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Cbl proto‐oncogene E3 ubiquitin protein ligase‐like 1, RNF188, Hakai (CBLL1) is an evolutionarily conserved E3 ubiquitin ligase containing a RING‐finger domain. CBLL1 contains a typical RING‐finger, short pTyr‐binding domain, and proline‐rich domain. CBLL1 expression is upregulated in human colon and gastric cancer tissues, and CBLL1 has been reported to induce anchorage‐dependent cell growth. CBLL1 immunostaining was observed in both the nuclei and cytoplasm of cancer cells. (PMID: 31124298, PMID: 31646569, PMID: 21191016) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30900 Product name: Recombinant human CBLL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 18-110 aa of BC027460 Sequence: DVRRRIPIKLISKQANKAKPAPRTQRTINRMPAKAPPGDEEGFDYNEEERYDCKGGELFANQRRFPGHLFWDFQINILGEKDDTPVHFCDKCG Predict reactive species Full Name: Cas-Br-M (murine) ecotropic retroviral transforming sequence-like 1 Calculated Molecular Weight: 491 aa, 55 kDa Observed Molecular Weight: 60-70 kDa GenBank Accession Number: BC027460 Gene Symbol: CBLL1 Gene ID (NCBI): 79872 RRID: AB_2918251 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q75N03 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.