Proteintech, 29237-1-AP, PPP2R2B/A/C/D Polyclonal antibody

Size: 20ul / 150ul The PPP2R2B/A/C/D (29237-1-AP) by Proteintech is a Polyclonal antibody targeting PPP2R2B/A/C/D in WB, IHC, ELISA applications with reactivity to Human, Mouse, Rat samples 29237-1-AP targets PPP2R2B/A/C/D in WB, IHC, ELISA applications and shows reactivity with Human, Mouse, Rat samples. Tested Applications Positive WB detected in: HepG2 cells, MCF-7 cells, mouse brain tissue, rat brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:400-1:800 Background Information The PPP2R2B gene encodes a deduced 443 amino acid protein of approximately 52 kDa, which is a brain-specific regulatory subunit B of protein phosphatase 2. PPP2R2B is a Subunit of PP2A, a highly conserved constitutive enzyme(PMID:11719278). PPP2R2B (Bβ) is an important regulator of protein phosphatase 2A (PP2A) activity in the brain. Through differential promoter usage and alternative splicing, two major isoforms Bβ1 and Bβ2 with divergent sub-cellular targeting N termini are produced. Bβ plays an important role in neuronal survival. It has 5 isoforms produced by alternative splicing. The antibody cross-reacts with PPP2R2A, PPP2R2C, and PPP2R2D due to high immunogen homology between PPP2R2B and PPP2R2A, PPP2R2C, and PPP2R2D. Specification Tested Reactivity: Human, Mouse, Rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30757 Product name: Recombinant human PPP2R2B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 290-443 aa of BC031790 Sequence: SHSGRYIMTRDYLTVKVWDLNMENRPIETYQVHDYLRSKLCSLYENDCIFDKFECVWNGSDSVIMTGSYNNFFRMFDRNTKRDVTLEASRENSKPRAILKPRKVCVGGKRRKDEISVDSLDFSKKILHTAWHPSENIIAVAATNNLYIFQDKVN Predict reactive species Full Name: protein phosphatase 2 (formerly 2A), regulatory subunit B, beta isoform Calculated Molecular Weight: 443 aa, 52 kDa Observed Molecular Weight: 52 kDa GenBank Accession Number: BC031790 Gene Symbol: PPP2R2B Gene ID (NCBI): 5521 RRID: AB_3086106 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q00005 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.