Proteintech, 29252-1-AP, HDAC4 Polyclonal antibody

Size: 20ul / 150ul The HDAC4 (29252-1-AP) by Proteintech is a Polyclonal antibody targeting HDAC4 in WB, IHC, ELISA applications with reactivity to Human samples 29252-1-AP targets HDAC4 in WB, IHC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HEK-293T cells, HeLa cells, Jurkat cells Positive IHC detected in: human ovary tumor tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information HDAC4 (Histone deacetylase 4) belongs to class II of the histone deacetylase/acuc/apha family. It possesses histone deacetylase activity and represses transcription when tethered to a promoter. Histone deacetylation gives a tag for epigenetic repression and plays a role in transcriptional regulation, cell cycle progression and developmental events. It is involved in muscle maturation by its interaction with the myocyte enhancer factors such as MEF2A, MEF2C and MEF2D. HDAC4 is required for TGFbeta1-induced myofibroblastic differentiation (PMID: 17610967). HDAC4 encoded by an allele associated with mental retardation is a gain-of-function nuclear repressor that abolishes transcription and synaptic transmission (PMID: 23141539). Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30752 Product name: Recombinant human HDAC4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 888-972 aa of BC039904 Sequence: LPEKVLQQRPNANAVRSMEKVMEIHSKYWRCLQRTTSTAGRSLIEAQTCENEEAETVTAMASLSVGVKPAEKRPDEEPMEEEPPL Predict reactive species Full Name: histone deacetylase 4 Calculated Molecular Weight: 972 aa, 106 kDa Observed Molecular Weight: 120-140 kDa GenBank Accession Number: BC039904 Gene Symbol: HDAC4 Gene ID (NCBI): 9759 RRID: AB_3086107 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P56524 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.