Proteintech, 29261-1-AP, MRP2 Polyclonal antibody

Size: 20ul / 150ul The MRP2 (29261-1-AP) by Proteintech is a Polyclonal antibody targeting MRP2 in WB, IHC, ELISA applications with reactivity to Human samples 29261-1-AP targets MRP2 in WB, IHC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: 37°C incubated A549 cells, 37°C incubated HepG2 cells Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information Multi-drug resistance protein 2 (MRP2), also known as ABCC2, is an ATP binding cassette (ABC) transporter responsible for biliary excretion of xenobiotics, endobiotics, and their metabolites. Deficiency in ABCC2 results in the clinical disorder Dubin-Johnson syndrome. MRP2 is found to be expressed in a variety of human cancers, and is associated with resistance of tumor cells to various anticancer drugs including cisplatin. The predicted molecular weight of MRP2 is 174 kDa, while mature MRP2 usually has a slower migration around 190-250 kDa due to the glycosylation. (16434545, 18834541, 23045960) Specification Tested Reactivity: Human Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30944 Product name: Recombinant human ABCC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1470-1545 aa of BC136419 Sequence: ETDNLIQTTIQNEFAHCTVITIAHRLHTIMDSDKVMVLDNGKIIECGSPEELLQIPGPFYFMAKEAGIENVNSTKF Predict reactive species Full Name: ATP-binding cassette, sub-family C (CFTR/MRP), member 2 Calculated Molecular Weight: 1545 aa, 174 kDa Observed Molecular Weight: 190-250 kDa GenBank Accession Number: BC136419 Gene Symbol: ABCC2 Gene ID (NCBI): 1244 RRID: AB_3086108 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q92887 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.