Proteintech, 29264-1-AP, SARS-COV-2 NSP12 Polyclonal antibody

Size: 20ul / 150ul The SARS-COV-2 NSP12 (29264-1-AP) by Proteintech is a Polyclonal antibody targeting SARS-COV-2 NSP12 in ELISA applications with reactivity to Virus samples 29264-1-AP targets SARS-COV-2 NSP12 in WB, IF, ELISA applications and shows reactivity with Virus samples. Tested Applications Positive ELISA detected in: Recombinant protein, N/A Recommended dilution Enzyme-linked Immunosorbent Assay (ELISA): ELISA : 1:10-1:100 Specification Tested Reactivity: Virus Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30931 Product name: Recombinant sars-cov-2 NSP12 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-200 aa of YP_009725307 Sequence: SADAQSFLNRVCGVSAARLTPCGTGTSTDVVYRAFDIYNDKVAGFAKFLKTNCCRFQEKDEDDNLIDSYFVVKRHTFSNYQHEETIYNLLKDCPAVAKHDFFKFRIDGDMVPHISRQRLTKYTMADLVYALRHFDEGNCDTLKEILVTYNCCDDDYFNKKDWYDFVENPDILRVYANLGERVRQALLKTVQFCDAMRNAG Predict reactive species Full Name: ORF1ab GenBank Accession Number: YP_009725307 Gene Symbol: SARS-COV-2 NSP8 Gene ID (NCBI): 43740578 RRID: AB_2918262 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.