Iright
BRAND / VENDOR: Proteintech

Proteintech, 29272-1-AP, GAB2 Polyclonal antibody

CATALOG NUMBER: 29272-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GAB2 (29272-1-AP) by Proteintech is a Polyclonal antibody targeting GAB2 in WB, IHC, ELISA applications with reactivity to Human samples 29272-1-AP targets GAB2 in WB, IHC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: K-562 cells Positive IHC detected in: human colon cancer tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Growth factor receptor-bound protein 2 (GAB2), an adaptor protein, belongs to the Gab family and is involved in various biologic processes. Gab2 mainly mediates phosphatidylinositol 3-kinase (PI3K) and extracellular signal-regulated kinase (ERK) signaling pathways. Furthermore, Gab2 governs tumorigenic signaling and is a novel potential therapeutic target in leukemia, breast cancer, ovarian cancer, and melanoma. Gab2 is the major 98-kDa phosphoprotein associated with SHP-2, PI 3-kinase, and Grb2 in normal human lymphocytes. (PMID: 32269703, PMID: 28842424, PMID: 28420432, PMID: 10849428) Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30347 Product name: Recombinant human GAB2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 588-676 aa of BC131711 Sequence: QNPVSASPVPSGTNSPAPKKSTGSVDYLALDFQPSSPSPHRKPSTSSVTSDEKVDYVQVDKEKTQALQNTMQEWTDVRQSSEPSKGAKL Predict reactive species Full Name: GRB2-associated binding protein 2 Calculated Molecular Weight: 676 aa, 74 kDa Observed Molecular Weight: 74-90 kDa GenBank Accession Number: BC131711 Gene Symbol: GAB2 Gene ID (NCBI): 9846 RRID: AB_2918265 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UQC2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924