Proteintech, 29280-1-AP, IFI16 Polyclonal antibody

Size: 20ul / 150ul The IFI16 (29280-1-AP) by Proteintech is a Polyclonal antibody targeting IFI16 in WB, IHC, IF/ICC, ELISA applications with reactivity to Human samples 29280-1-AP targets IFI16 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: Daudi cells, Jurkat cells, MOLT-4 cells, Ramos cells Positive IHC detected in: human renal cell carcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information IFI16 is a member of a family of interferon-inducible nuclear proteins involved in transcriptional regulation functions as a transcriptional repressor. IFI16 may be involved in TP53-mediated transcriptional activation by enhancing TP53 sequence-specific DNA binding and modulating TP53 phosphorylation status. It has been reported that IFI16 participates in the regulation of autophagy, TP53-mediated cell death and innate immune response. IFI16 has different isoforms and 67790-1-Ig antibody detects proteins around 85-95 kDa in SDS-PAGE similar to papers. (PMID: 9718316, 14990579, 11146555, 22046441) Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30297 Product name: Recombinant human IFI16 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 580-729 aa of BC017059 Sequence: VCRNGFLEVYPFTLVADVNADRNMEIPKGLIRSASVTPKINQLCSQTKGSFVNGVFEVHKKNVRGEFTYYEIQDNTGKMEVVVHGRLTTINCEEGDKLKLTCFELAPKSGNTGELRSVIHSHIKVIKTRKNKKDILNPDSSMETSPDFFF Predict reactive species Full Name: interferon, gamma-inducible protein 16 Calculated Molecular Weight: 729 aa, 82 kDa Observed Molecular Weight: 85-95 kDa GenBank Accession Number: BC017059 Gene Symbol: IFI16 Gene ID (NCBI): 3428 RRID: AB_3086109 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q16666 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.