Proteintech, 29293-1-AP, BRWD1 Polyclonal antibody

Size: 20ul / 150ul The BRWD1 (29293-1-AP) by Proteintech is a Polyclonal antibody targeting BRWD1 in WB, IHC, ELISA applications with reactivity to human, mouse samples 29293-1-AP targets BRWD1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HepG2 cells, MCF-7 cells, NIH/3T3 cells Positive IHC detected in: mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information BRWD1 (Bromodomain and WD repeat domain containing 1, also known as WDR9) has a predicted molecular weight of 263 kDa and contains tandem BROMO domains and WD40 repeats (PMID:12889071). One of the remarkable functions of BRWD1 was the coordinated repression of MYC and MYC target genes. At the Myc/MYC locus, in both mice and humans, BRWD1 specififically repressed distal enhancers, which are associated with lineage specifific expression (PMID:30250168). In addition,BRWD1 as a key epigenomic mediator of normal neurodevelopment and an important contributor to DS (Down syndrome)-related phenotypes (PMID:36289231). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30902 Product name: Recombinant human BRWD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-120 aa of BC064602 Sequence: MAEPSSARRPVPLIESELYFLIARYLSAGPCRRAAQVLVQELEQYQLLPKRLDWEGNEHNRSYEELVLSNKHVAPDHLLQICQRIGPMLDKEIPPSISRVTSLLGAGRQSLLRTAKGTLI Predict reactive species Full Name: bromodomain and WD repeat domain containing 1 Calculated Molecular Weight: 2320 aa, 263 kDa Observed Molecular Weight: 263 kDa GenBank Accession Number: BC064602 Gene Symbol: BRWD1 Gene ID (NCBI): 54014 RRID: AB_3086110 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NSI6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.