Proteintech, 29305-1-AP, PCNP Polyclonal antibody

Size: 20ul / 150ul The PCNP (29305-1-AP) by Proteintech is a Polyclonal antibody targeting PCNP in WB, IHC, ELISA applications with reactivity to Human samples 29305-1-AP targets PCNP in WB, IHC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: A2780 cells, Jurkat cells Positive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30951 Product name: Recombinant human PCNP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-68 aa of BC013916 Sequence: MADGKAGDEKPEKSQRAGAAGGPEEEAEKPVKTKTVSSSNGGESSSRSAEKRSAEEEAADLPTKPTKI Predict reactive species Full Name: PEST proteolytic signal containing nuclear protein Calculated Molecular Weight: 19 kDa Observed Molecular Weight: 24-28 kDa GenBank Accession Number: BC013916 Gene Symbol: PCNP Gene ID (NCBI): 57092 RRID: AB_2918277 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WW12 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.