Iright
BRAND / VENDOR: Proteintech

Proteintech, 29307-1-AP, PAX2 Polyclonal antibody

CATALOG NUMBER: 29307-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PAX2 (29307-1-AP) by Proteintech is a Polyclonal antibody targeting PAX2 in WB, IHC, ELISA applications with reactivity to Human, mouse, rat samples 29307-1-AP targets PAX2 in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: mouse cerebellum tissue, rat cerebellum tissue Positive IHC detected in: mouse kidney tissue, human renal cell carcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information PAX2 is a transcription factor, primarily expressed during embryonic development. It has a critical role in the development of the urogenital tract, the eyes, and the CNS. It plays a key role during renal development and to act as an oncogene favoring renal tumor growth. PAX2 was suggested as a sensitive and highly specific marker for renal cell carcinoma (RCC). Specification Tested Reactivity: Human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30717 Product name: Recombinant human PAX2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 189-386 aa of BC148710 Sequence: GILGIPRSNGEKRKRDEVEVYTDPAHIRGGGGLHLVWTLRDVSEGSVPNGDSQSGVDSLRKHLRADTFTQQQLEALDRVFERPSYPDVFQASEHIKSEQGNEYSLPALTPGLDEVKSSLSASTNPELGSNVSGTQTYPVVTGRDMASTTLPGYPPHVPPTGQGSYPTSTLAGMVPGSEFSGNPYSHPQYTAYNEAWRF Predict reactive species Full Name: paired box 2 Calculated Molecular Weight: 431 aa, 46 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC148710 Gene Symbol: PAX2 Gene ID (NCBI): 5076 RRID: AB_2918278 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q02962 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924