Proteintech, 29312-1-AP, Parvalbumin Polyclonal antibody

Size: 20ul / 150ul The Parvalbumin (29312-1-AP) by Proteintech is a Polyclonal antibody targeting Parvalbumin in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 29312-1-AP targets Parvalbumin in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, mouse skeletal muscle tissue, rat brain tissue, rat skeletal muscle tissue Positive IHC detected in: mouse cerebellum tissue, mouse brain tissue, rat cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse cerebellum tissue, mouse brain tissue, rat cerebellum tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information PVALB is a high affinity calcium ion-binding protein that is structurally and functionally similar to calmodulin and troponin C. PVALB is expressed in high levels only in fast-contracting muscles and at lower levels in brain and several endocrine tissues. It is thought to be involved in muscle relaxation. Monomeric (12 kDa) and dimeric (24 kDa) forms, as well as trimeric Parvalbumin (38 kDa), have been described in a literature (PMID: 19616851). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30189 Product name: Recombinant human PVALB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2-110 aa of NM_002854 Sequence: SMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES Predict reactive species Full Name: parvalbumin Calculated Molecular Weight: 12 kDa Observed Molecular Weight: 15 kDa GenBank Accession Number: NM_002854 Gene Symbol: Parvalbumin Gene ID (NCBI): 5816 RRID: AB_2918280 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P20472 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.