Iright
BRAND / VENDOR: Proteintech

Proteintech, 29321-1-AP, SPATA2 Polyclonal antibody

CATALOG NUMBER: 29321-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SPATA2 (29321-1-AP) by Proteintech is a Polyclonal antibody targeting SPATA2 in WB, IHC, IF/ICC, ELISA applications with reactivity to Human, mouse, rat samples 29321-1-AP targets SPATA2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, rat testis tissue Positive IHC detected in: mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information The protein SPATA2 (spermatogenesis-associated protein 2) was initially shown to be highly expressed in testicular Sertoli cells, and these early reports suggested SPATA2 to play a role in spermatogenesis. More recently, it was discussed to be involved in the predisposition for psoriasis. SPATA2 is required for TNF-induced cell death. SPATA2 has a potential role during pancreatic development and β-cell proliferation.(PMID: 20119533/PMID: 27458237) Specification Tested Reactivity: Human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30773 Product name: Recombinant human SPATA2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 330-520 aa of BC009481 Sequence: STQDDVDLYTDSEPRATYRRQDALRPDVWLLRNDAHSLYHKRSPPAKESALSKCQSCGLSCSSSLCQRCDSLLTCPPASKPSAFPSKASTHDSLAHGASLREKYPGQTQGLDRLPHLHSKSKPSTTPTSRCGFCNRPGATNTCTQCSKVSCDACLSAYHYDPCYKKSELHKFMPNNQLNYKSTQLSHLVYR Predict reactive species Full Name: spermatogenesis associated 2 Calculated Molecular Weight: 58 kDa Observed Molecular Weight: 58-60 kDa GenBank Accession Number: BC009481 Gene Symbol: SPATA2 Gene ID (NCBI): 9825 RRID: AB_2918282 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UM82 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924