Iright
BRAND / VENDOR: Proteintech

Proteintech, 29329-1-AP, GPX1 Polyclonal antibody

CATALOG NUMBER: 29329-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GPX1 (29329-1-AP) by Proteintech is a Polyclonal antibody targeting GPX1 in WB, ELISA applications with reactivity to Human, Mouse, Rat samples 29329-1-AP targets GPX1 in WB, IHC, IF, ELISA applications and shows reactivity with Human, Mouse, Rat samples. Tested Applications Positive WB detected in: HEK-293 cells, THP-1 cells, mouse kidney tissue, rat kidney tissue, SMMC-7721 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information Gpx protein, known as selenoprotein, consists selenium in its catalytic site. Gpx1 is an abundant isoform, which involves in scavenging endogenous ROS using electron provided by reduced glutathione and ubiquitously expressed the cytoplasm and mitochondria of all cell types. (PMID: 30632027) Specification Tested Reactivity: Human, Mouse, Rat Cited Reactivity: human, mouse, rat, pig, chicken, bovine Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31101 Product name: Recombinant human GPX1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 102-203 aa of BC000742 Sequence: GGGFEPNFMLFEKCEVNGAGAHPLFAFLREALPAPSDDATALMTDPKLITWSPVCRNDVAWNFEKFLVGPDGVPLRRYSRRFQTIDIEPDIEALLSQGPSCA Predict reactive species Full Name: glutathione peroxidase 1 Calculated Molecular Weight: 22 kDa Observed Molecular Weight: 22 kDa GenBank Accession Number: BC000742 Gene Symbol: GPX1 Gene ID (NCBI): 2876 RRID: AB_2918283 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P07203 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924