Iright
BRAND / VENDOR: Proteintech

Proteintech, 29330-1-AP, Renin Polyclonal antibody

CATALOG NUMBER: 29330-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Renin (29330-1-AP) by Proteintech is a Polyclonal antibody targeting Renin in WB, IF/ICC, ELISA applications with reactivity to human, monkey samples 29330-1-AP targets Renin in WB, IF/ICC, ELISA applications and shows reactivity with human, monkey samples. Tested Applications Positive WB detected in: COS-7 cells, HepG2 cells Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Renin is an aspartic protease that consists of 2 homologous lobes, produced as pre-prorenin protein and transferred into the cisterns of the endoplasmic reticulum. Renin is mainly produced and released into circulation by the so-called juxtaglomerular epithelioid cells, located in the walls of renal afferent arterioles at the entrance of the glomerular capillary network (PMID: 16525949).REN has 2 isoforms produced by alternative splicing with a molecular weight of 45-47kDa. Specification Tested Reactivity: human, monkey Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31071 Product name: Recombinant human REN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 112-235 aa of BC047752 Sequence: VPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENS Predict reactive species Full Name: renin Calculated Molecular Weight: 45 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC047752 Gene Symbol: Renin Gene ID (NCBI): 5972 RRID: AB_3086119 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P00797 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924