Product Description
Size: 20ul / 150ul
The Renin (29330-1-AP) by Proteintech is a Polyclonal antibody targeting Renin in WB, IF/ICC, ELISA applications with reactivity to human, monkey samples
29330-1-AP targets Renin in WB, IF/ICC, ELISA applications and shows reactivity with human, monkey samples.
Tested Applications
Positive WB detected in: COS-7 cells, HepG2 cells
Positive IF/ICC detected in: HepG2 cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:1000
Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
Background Information
Renin is an aspartic protease that consists of 2 homologous lobes, produced as pre-prorenin protein and transferred into the cisterns of the endoplasmic reticulum. Renin is mainly produced and released into circulation by the so-called juxtaglomerular epithelioid cells, located in the walls of renal afferent arterioles at the entrance of the glomerular capillary network (PMID: 16525949).REN has 2 isoforms produced by alternative splicing with a molecular weight of 45-47kDa.
Specification
Tested Reactivity: human, monkey
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag31071 Product name: Recombinant human REN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 112-235 aa of BC047752 Sequence: VPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENS Predict reactive species
Full Name: renin
Calculated Molecular Weight: 45 kDa
Observed Molecular Weight: 45 kDa
GenBank Accession Number: BC047752
Gene Symbol: Renin
Gene ID (NCBI): 5972
RRID: AB_3086119
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P00797
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924