Product Description
Size: 20ul / 150ul
The HDAC5 (29342-1-AP) by Proteintech is a Polyclonal antibody targeting HDAC5 in WB, IHC, IF/ICC, ELISA applications with reactivity to Human, mouse samples
29342-1-AP targets HDAC5 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, mouse samples.
Tested Applications
Positive WB detected in: HEK-293 cells, HepG2 cells, MCF-7 cells, PC-3 cells
Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF/ICC detected in: HepG2 cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:1000
Immunohistochemistry (IHC): IHC : 1:50-1:500
Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
Background Information
Histone acetylation and deacetylation alternately exposes and occludes DNA to transcription factors. At least 4 classes of HDAC were identified. HDAC5 is a class II HDAC. HDAC5 responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. HDAC5 is involved in muscle maturation by repressing transcription of myocyte enhancer MEF2C. During muscle differentiation, HDAC5 shuttles into the cytoplasm, allowing the expression of myocyte enhancer factors.
Specification
Tested Reactivity: Human, mouse
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag29122 Product name: Recombinant human HDAC5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 557-682 aa of NM_005474 Sequence: TEQQEVLLGEGALTMPREGSTESESTQEDLEEEDEEDDGEEEEDCIQVKDEEGESGAEEGPDLEEPGAGYKKLFSDAQPLQPLQVYQAPLSLATVPHQALGRTQSSPAAPGGMKSPPDQPVKHLFT Predict reactive species
Full Name: histone deacetylase 5
Calculated Molecular Weight: 122 kDa
Observed Molecular Weight: 120-140 kDa
GenBank Accession Number: NM_005474
Gene Symbol: HDAC5
Gene ID (NCBI): 10014
RRID: AB_3086120
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q9UQL6
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924