Proteintech, 29352-1-AP, NPPC Polyclonal antibody

Size: 20ul / 150ul The NPPC (29352-1-AP) by Proteintech is a Polyclonal antibody targeting NPPC in IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 29352-1-AP targets NPPC in IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: rat heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse heart tissue Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information NPPC (C-type natriuretic peptide) is also named as CNP2, and belongs to the natriuretic peptide family. More recent studies have shown that in growing and preovulatory follicles, granulosa cells secrete into the follicular fluid, a C-type natriuretic peptide (NPPC, also known as CNP) capable of binding to cumulus cells membrane natriuretic peptide receptor 2 (NPR2, also known as guanylate cyclase B). The CNP/NPR2 complex, acting actively as guanylate cyclase, increases the concentration of cGMP both in cumulus cells and, indirectly, in the oocyte, maintaining meiosis arrest. The cAMP level is maintained due to the upstream activity type C natriuretic peptide (CNP, NPPC), produced by the granulosa cells, which is responsible for the production of cyclic guanosine monophosphate (cGMP) after binding to a specific NPR2 receptor (PMID: 35209923, PMID: 25183874, PMID: 20947764). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29609 Product name: Recombinant human NPPC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 74-126 aa of NM_024409 Sequence: DLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC Predict reactive species Full Name: natriuretic peptide precursor C Calculated Molecular Weight: 13 kDa GenBank Accession Number: NM_024409 Gene Symbol: NPPC Gene ID (NCBI): 4880 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P23582 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.