Iright
BRAND / VENDOR: Proteintech

Proteintech, 29387-1-AP, VPS13D Polyclonal antibody

CATALOG NUMBER: 29387-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The VPS13D (29387-1-AP) by Proteintech is a Polyclonal antibody targeting VPS13D in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 29387-1-AP targets VPS13D in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information VPS13 (vacuolar protein sorting 13 ) acts at membrane contact sites between intracellular organelles to transport lipids. There are four VPS13 family members in human - VPS13A, VPS13B, VPS13C and VPS13D. Mutations in human VPS13 genes are linked to rare neurodegenerative disorders: chorea- acanthocytosis (VPS13A), Cohen syndrome (VPS13B), predispose to early onset into Parkinson disease (VPS13C) and lead to ataxia/spastic paraplegia (VPS13D) (PMID: 30656912). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29933 Product name: Recombinant human VPS13D protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 4202-4388 aa of NM_015378 Sequence: DFASETAQAVRDTATLSGPRTQAQRVRKPRCCTGPQGLLPRYSESQAEGQEQLFKLTDNIQDEFFIAVENIDSYCVLISSKAVYFLKSGDYVDREAIFLEVKYDDLYHCLVSKDHGKVYVQVTKKAVSTSSGVSIPGPSHQKPMVHVKSEVLAVKLSQEINYAKSLYYEQQLMLRLSENREQLELDS Predict reactive species Full Name: vacuolar protein sorting 13 homolog D (S. cerevisiae) Calculated Molecular Weight: 492 kDa Observed Molecular Weight: ~500 kDa GenBank Accession Number: NM_015378 Gene Symbol: VPS13D Gene ID (NCBI): 55187 RRID: AB_3086126 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5THJ4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924