Iright
BRAND / VENDOR: Proteintech

Proteintech, 29398-1-AP, ATP8 Polyclonal antibody

CATALOG NUMBER: 29398-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ATP8 (29398-1-AP) by Proteintech is a Polyclonal antibody targeting ATP8 in WB, ELISA applications with reactivity to human samples 29398-1-AP targets ATP8 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, 143B cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30024 Product name: Recombinant human MT-ATP8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-68 aa of Sequence: MPQLNTTVWPTMITPMLLTLFLITQLKMLNTNYHLPPSPKPMKMKNYNKPWEPKWTKICSLHSLPPQS Predict reactive species Full Name: ATP synthase 8; ATPase subunit 8 Calculated Molecular Weight: 8 kDa Observed Molecular Weight: 8-10 kDa Gene Symbol: ATP8 Gene ID (NCBI): 4509 RRID: AB_2918293 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P03928 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924