Iright
BRAND / VENDOR: Proteintech

Proteintech, 29407-1-AP, FAM111B Polyclonal antibody

CATALOG NUMBER: 29407-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FAM111B (29407-1-AP) by Proteintech is a Polyclonal antibody targeting FAM111B in WB, IHC, ELISA applications with reactivity to Human samples 29407-1-AP targets FAM111B in WB, IHC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: BxPC-3 cells, HeLa cells, Jurkat cells, MCF-7 cells, SW 1990 cells Positive IHC detected in: human lung cancer tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:18000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: Human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29376 Product name: Recombinant human FAM111B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 230-465 aa of BC130539 Sequence: RFRSDIGEFEWKLKEGHKKIYGKQSMVDEVSGKVLEMDISKKKALQQKDIHKKIKQNESATDEINHQSLIQSKKKVHKPKKDGETKDVEHSREQILPPQDLSHYIKDKTRQTIPRIRNYYFCSLPRKYRQINSQVRRRPHLGRRYAINLDVQKEAINLLKNYQTLNEAIMHQYPNFKEEAQWVRKYFREEQKRMNLSPAKQFNIYKKDFGKMTANSVSVATCEQLTYYSKSVGFMQ Predict reactive species Full Name: family with sequence similarity 111, member B Observed Molecular Weight: 85 kDa GenBank Accession Number: BC130539 Gene Symbol: FAM111B Gene ID (NCBI): 374393 RRID: AB_2918299 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6SJ93 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924