Proteintech, 29457-1-AP, DLG2 Polyclonal antibody

Size: 20ul / 150ul The DLG2 (29457-1-AP) by Proteintech is a Polyclonal antibody targeting DLG2 in WB, ELISA applications with reactivity to Human, Mouse, Rat samples 29457-1-AP targets DLG2 in WB, ELISA applications and shows reactivity with Human, Mouse, Rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information Disks large homolog 2 (DLG2) also known as channel-associated protein of synapse-110 (chapsyn-110) or postsynaptic density protein 93 (PSD-93) is a protein encoded by the DLG2 gene. Chapsyn-110/PSD-93 is a member of the membrane-associated guanylate kinase (MAGUK) family. The protein forms a heterodimer with a related family member that may interact at postsynaptic sites to form a multimeric scaffold for the clustering of receptors, ion channels, and associated signaling proteins (PMID: 8755482 9806853). Specification Tested Reactivity: Human, Mouse, Rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30193 Product name: Recombinant human DLG2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 295-417 aa of NM_001142699 Sequence: HSYSPPMENHLLSGNNGTLEYKTSLPPISPGRYSPIPKHMLVDDDYTRPPEPVYSTVNKLCDKPASPRHYSPVECDKSFLLSAPYSHYHLGLLPDSEMTSHSQHSTATRQPSMTLQRAVSLEG Predict reactive species Full Name: discs, large homolog 2 (Drosophila) Calculated Molecular Weight: 98 kDa Observed Molecular Weight: 110 kDa GenBank Accession Number: NM_001142699 Gene Symbol: DLG2 Gene ID (NCBI): 1740 RRID: AB_3086135 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15700 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.