Proteintech, 29496-1-AP, COQ10A Polyclonal antibody

Size: 20ul / 150ul The COQ10A (29496-1-AP) by Proteintech is a Polyclonal antibody targeting COQ10A in WB, ELISA applications with reactivity to human, mouse, rat samples 29496-1-AP targets COQ10A in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse heart tissue, mouse skeletal muscle tissue, rat heart tissue, rat skeletal muscle tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information COQ10A is a human gene that encodes a protein involved in the biosynthesis of coenzyme Q10 (CoQ10), also known as ubiquinone. CoQ10 is a lipid-soluble antioxidant and a critical component of the mitochondrial electron transport chain, where it plays a key role in cellular energy production (ATP synthesis). Mutations or deficiencies in COQ10A have been implicated in primary CoQ10 deficiency syndromes, which can manifest as mitochondrial disorders such as encephalomyopathy, nephropathy, and Leigh syndrome. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31534 Product name: Recombinant human COQ10A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-247 aa of NM_144576 Sequence: MAWAGSRRVPAGTRAAAERCCRLSLSPGAQPAPPPGPLPPPRPMRFLTSCSLLLPRAAQILAAEAGLPSSRSFMGFAAPFTNKRKAYSERRIMGYSMQEMYEVVSNVQEYREFVPWCKKSLVVSSRKGHLKAQLEVGFPPVMERYTSAVSMVKPHMVKAVCTDGKLFNHLETIWRFSPGIPAYPRTCTVDFSISFEFRSLLHSQLATMFFDEVVKQNVAAFERRAATKFGPETAIPRELMFHEVHQT Predict reactive species Full Name: coenzyme Q10 homolog A (S. cerevisiae) Calculated Molecular Weight: 28KD Observed Molecular Weight: 20 kDa GenBank Accession Number: NM_144576 Gene Symbol: COQ10A Gene ID (NCBI): 93058 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96MF6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.