Iright
BRAND / VENDOR: Proteintech

Proteintech, 29508-1-AP, Annexin A4 Polyclonal antibody

CATALOG NUMBER: 29508-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Annexin A4 (29508-1-AP) by Proteintech is a Polyclonal antibody targeting Annexin A4 in WB, ELISA applications with reactivity to Human, rat, mouse samples 29508-1-AP targets Annexin A4 in WB, ELISA applications and shows reactivity with Human, rat, mouse samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, mouse kidney tissue, mouse liver tissue, mouse lung tissue, rat kidney tissue, NIH/3T3 cells, RAW 264.7 cells, HuH-7 cells, PC-12 cells, C6 cells, human placenta tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information Annexin A4 (Anxa4) is one of the Ca2 +-regulated and phospholipid-binding annexin superfamily proteins, and is located at 2p13. Anxa4 has a potential role in diagnosis, prognosis, and treatment of certain cancers. Annexin A4 shares 45 to 59% identity with other members and possibly interacts with ATP. Annexin A4 has in vitro anticoagulant activity and also inhibits phospholipase A2 activity. The Annexin A4 protein is expressed in a wide range of tissues, associated with polarized epithelial cells and is proposed to be involved in the regulation of chloride ions across the epithelial membrane. Specification Tested Reactivity: Human, rat, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30827 Product name: Recombinant human Annexin IV protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 118-274 aa of BC000182 Sequence: RTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAEKLYKSMKGLGTDDNTLIRVM Predict reactive species Full Name: annexin A4 Calculated Molecular Weight: 36 kDa Observed Molecular Weight: 36 kDa GenBank Accession Number: BC000182 Gene Symbol: Annexin A4 Gene ID (NCBI): 307 RRID: AB_2918319 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P09525 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924