Proteintech, 29511-1-AP, P54 of ASFV Polyclonal antibody

Size: 20ul / 150ul The P54 of ASFV (29511-1-AP) by Proteintech is a Polyclonal antibody targeting P54 of ASFV in ELISA applications with reactivity to asfv samples 29511-1-AP targets P54 of ASFV in ELISA applications and shows reactivity with asfv samples. Tested Applications Positive ELISA detected in: FusionProtein Recommended dilution Enzyme-linked Immunosorbent Assay (ELISA): ELISA : 1:556544-1:2226176 Specification Tested Reactivity: asfv Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31444 Product name: Recombinant asfv P54 of ASFV protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-65 aa of AAA65354 Sequence: VLIYLFSSRKKKAAAAIEEEDIQFINPYQDQQWAEVTPQPGTSKPAGATTASAGKPVTGRPATNR Predict reactive species Full Name: Envelope protein p54 Calculated Molecular Weight: 20 kDa GenBank Accession Number: AAA65354 Gene Symbol: P54 of ASFV Gene ID (NCBI): 22220355 RRID: AB_2923593 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q65194 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.