Proteintech, 29512-1-AP, P72 of ASFV Polyclonal antibody

Size: 20ul / 150ul The P72 of ASFV (29512-1-AP) by Proteintech is a Polyclonal antibody targeting P72 of ASFV in ELISA applications with reactivity to asfv samples 29512-1-AP targets P72 of ASFV in ELISA applications and shows reactivity with asfv samples. Tested Applications Positive ELISA detected in: FusionProtein Recommended dilution Enzyme-linked Immunosorbent Assay (ELISA): ELISA : 1:128000-1:512000 Specification Tested Reactivity: asfv Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31445 Product name: Recombinant asfv P72 of ASFV protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-117 aa of M34142 Sequence: DEYSSDVTTLVRKFCIPGDKMTGYKHLVGQEVSVEGTSGPLLCNIHDLHKPHQSKPILTDENDTQRTCSHTNPKFLSQHFPENSHNIQTAGKQDITPITDATYLDIRRNVHYSCNGP Predict reactive species Full Name: Major capsid protein Calculated Molecular Weight: 72 kDa GenBank Accession Number: M34142 Gene Symbol: P72 of ASFV Gene ID (NCBI): 22220311 RRID: AB_2923594 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P22776 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.