Iright
BRAND / VENDOR: Proteintech

Proteintech, 29550-1-AP, RBP4 Polyclonal antibody

CATALOG NUMBER: 29550-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RBP4 (29550-1-AP) by Proteintech is a Polyclonal antibody targeting RBP4 in WB, ELISA applications with reactivity to human samples 29550-1-AP targets RBP4 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, human plasma Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information RBP4 (Retinol-binding protein 4), also known as PRO2222. It is expected to be located in the cytoplasm, which is expressed in renal tubules, pancreatic islets and hepatocytes with positivity in plasma. This protein belongs to the lipocalin family and is the specific carrier for retinol (vitamin A alcohol) in the blood. It delivers retinol from the liver stores to the peripheral tissues. In plasma, the RBP-retinol complex interacts with transthyretin which prevents its loss by filtration through the kidney glomeruli. A deficiency of vitamin A blocks secretion of the binding protein post- translationally and results in defective delivery and supply to the epidermal cells. The molecular weight of RBP4 is 23 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg31642 Product name: Recombinant Human RBP4 protein (Myc Tag, His Tag) Source: mammalian cells -derived, pHZ-KIsec Tag: Myc & 6*His Domain: 19-201 aa of BC020633 Sequence: ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL Predict reactive species Full Name: retinol binding protein 4, plasma Calculated Molecular Weight: 201 aa, 23 kDa Observed Molecular Weight: 23 kDa GenBank Accession Number: BC020633 Gene Symbol: RBP4 Gene ID (NCBI): 5950 RRID: AB_3669688 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P02753 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924