Proteintech, 29591-1-AP, SULF2 Polyclonal antibody

Size: 20ul / 150ul The SULF2 (29591-1-AP) by Proteintech is a Polyclonal antibody targeting SULF2 in WB, ELISA applications with reactivity to Human, mouse samples 29591-1-AP targets SULF2 in WB, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive WB detected in: mouse liver tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Heparan sulfate proteoglycans (HSPGs) act as coreceptors for numerous heparin-binding growth factors and cytokines and are involved in cell signaling. SULF2 can remove sulfate from the C-6 position of glucosamine within specific subregions of intact heparin (PMID:12368295, PMID:30788513, PMID:35294879). Specification Tested Reactivity: Human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31106 Product name: Recombinant human SULF2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 481-720 aa of BC110539 Sequence: MRLGGSRALSNLVPKYYGQGSEACTCDSGDYKLSLAGRRKKLFKKKYKASYVRSRSIRSVAIEVDGRVYHVGLGDAAQPRNLTKRHWPGAPEDQDDKDGGDFSGTGGLPDYSAANPIKVTHRCYILENDTVQCDLDLYKSLQAWKDHKLHIDHEIETLQNKIKNLREVRGHLKKKRPEECDCHKISYHTQHKGRLKHRGSSLHPFRKGLQEKDKVWLLREQKRKKKLRKLLKRLQNNDTC Predict reactive species Full Name: sulfatase 2 Observed Molecular Weight: 140 kDa GenBank Accession Number: BC110539 Gene Symbol: SULF2 Gene ID (NCBI): 55959 RRID: AB_3086143 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IWU5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.